PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.260060.1
Common NameCsa_3G116700, LOC101216931
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 220aa    MW: 25284.9 Da    PI: 8.1638
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.260060.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.5e-32145203159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  Cucsa.260060.1 145 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHT 203
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.7E-34130203IPR003657WRKY domain
SuperFamilySSF1182901.7E-28137203IPR003657WRKY domain
PROSITE profilePS5081129.608140202IPR003657WRKY domain
SMARTSM007741.2E-37145204IPR003657WRKY domain
PfamPF031063.1E-25146202IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
METGTQTQRS SGRGEDYEVQ VSFHLSNDPH HIHEMGFVQL EEHSQVLSFL APNNNNNTTN  60
MPPPPFTTTS PHSNILPRPP SWTNHQLPGT LDPKPGNDEN CTATATDATN SWWRNTNADK  120
SKVKVRRKLR EPRFCFQTRS DVDVLDDGYK WRKYGQKVVK NSLHPRSYYR CTHSNCRVKK  180
RVERLSEDCR MVITTYEGRH NHTPCDDSNS SEHEPFTSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-26136202874Probable WRKY transcription factor 4
2lex_A5e-26136202874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123129KVRRKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818481e-128LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132601e-128LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004133758.11e-165PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY43e-66WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0A0L3J01e-165A0A0A0L3J0_CUCSA; Uncharacterized protein
STRINGGLYMA03G25770.14e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72943245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.15e-67WRKY family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]